porncakes instagram photo

#

Holly Moon 🍰BANANA BREAD🍰 IL ÉTAIT MAIS JUSTE DÉLICIEUX! LA RECETTE ÇA V

Holly Moon

  • 17.10.2017 12:51
  • 0

🍰BANANA BREAD🍰 IL ÉTAIT MAIS JUSTE DÉLICIEUX! LA RECETTE ÇA VOUS DIT? #pornfood #instafood #recipe #cake #bananabread #sugar #pecans #yumi #porncakes #hollymoonblog

Ema Emanuela Yumm🌹 #vanillacake #chocolate #foodie #porncakes #yummy #yumm #insp

Ema Emanuela

  • 17.10.2017 12:11
  • 1

Yumm🌹 #vanillacake #chocolate #foodie #porncakes #yummy #yumm #inspo #vegan #fashionista #delish #fashion #fashionblogger #luxury #luxuruwedding #luxurytravel #luxuryfashion #design #decoration #photography #photographer #fitness #motivation #beach #saludable #healthy

lolascakery_id one of our favorite cakes in @lolascakery_id “Red Velvet Cake”,,

lolascakery_id

  • 17.10.2017 11:07
  • 0

one of our favorite cakes in @lolascakery_id “Red Velvet Cake” , , For more info & order: Line : lolafarhan . WA : 082124614511 , , #cake #desserts #moussecake #redvelvetcake #cheesecakes #cheesecakelover #spongecake #unbaked #ilovebaking #ilovechocolate #sweet #sugarrush #mirrorglaze #mirrorglazecake #premiumcake #cakejakarta #cakephotography #porncakes #weddingcake #foodporn #cakeporn #jualcake #jualcakejakarta #jualdessert #jualmirrorcake #desserttablejakarta #celebration

Culina Training Center Bahrain Madeleine - Pastry Initiation #pastrychef#pastry#saudibaking#bahrainba

Culina Training Center Bahrain

  • 16.10.2017 11:31
  • 0

Madeleine - Pastry Initiation #pastrychef#pastry#saudibaking#bahrainbakingschool#bahrainbakingclass#certifiedculinaryeducator#approved#cookingschool#cookingcourse#culinaryarts#bahraincookingclass#saudicooking#bakers#bahrainbakers#cakebaking#trending#viral#pornfood#porncakes

 🇵🇱Dzisiaj słodka inspiracja na jaglane brownie, zmodyfikowane z

  • 16.10.2017 10:09
  • 1

🇵🇱Dzisiaj słodka inspiracja na jaglane brownie, zmodyfikowane z przepisu od @sara_haj 🤗 ✔️szklanka kaszy jaglanej ✔️szklanka ciemnego kakao ✔️2 jajka ✔️1 łyżka oleju kokosowego ✔️180g jogurtu greckiego ✔️4 łyżki cukru brązowego ✔️ 1 proszek do pieczenia 1. Ugotować kasze i wystudzić. 2. Dodać resztę i zblendować. 3. Piec w blaszce wyłożonej papierem do pieczenia ok. 50 min 160 🌡 4. Wystudzić przed krojeniem‼️ 5.Udekorować (u mnie jogurt grecki, kiwi i rodzynki). 🇬🇧Today sweet inspiration is millet brownie, modified from @sara_haj 's recipe! Very wet and soft! 😍 ✔️1 glass of millet ✔️1 glass of good cocoa ✔️180g of greek yogurt ✔️4 tbsp of brown sugar ✔️2 eggs ✔️1 baking powder ✔️1 tbsp of coconut oil 1. Boil the millet and cool down. 2. Add rest and blend. 3. Bake in the form filled with baking paper for 50 minutes at 160. 4. Cool down before you cut‼️ 5. Enjoy 😍 Toppings: greek yogurt, kiwi, raisins 🍰 #pornfood #porncakes #fitfood #fitcakes #fitness #fitfreak #gymfood #gymfreak #fitrecipes #delicious #yummy #motivation #inspiration #doityourself #gym #fitness #foodlove #eathealthy #eatclean #behappy #behealthy

Cake Decorating This is a big chocolate job!😋😍 FOLLOW US @cakedecorating_org

Cake Decorating

  • 16.10.2017 00:14
  • 3

This is a big chocolate job!😋😍 FOLLOW US @cakedecorating_org

mo_artycakes ,Solihull Let nature be your inspiration for your creation not people’s work!!

mo_artycakes ,Solihull

  • 15.10.2017 13:30
  • 0

Let nature be your inspiration for your creation not people’s work!! 🙏🙏🙏🙏🙏🙏#cakes#cake#cakeidea #birthdaycakes #porncakes #poshcakes #poshcafe #poshcakedesigns #cakedecorating #cakeart #cakefoto #cakeideas #flowercake #artcakes #beautifulcake #weddingcakes #creativecakes #luxurycakes #30thbirthdaycake

Nuria M.Atienzar 💎 🍓💖SWEET SUNDAY🍓💖 #diumengue #diumenguesdiferents #tartalet

Nuria M.Atienzar 💎

  • 15.10.2017 11:20
  • 2

🍓💖SWEET SUNDAY🍓💖 #diumengue #diumenguesdiferents #tartaletas #tartaletasdefrutas🍐🍏🍎🍒 #cheesecakes #meduixas #mangos #cackes #cackestagram #sauledapastissers #porncakes #porncakesunday #sauledapastissers #santpoldemar #maresmegourmet

whippywhisper Bride to be cake....For order / full pict 👉 wa 08992100111#whipp

whippywhisper

  • 15.10.2017 03:17
  • 0

Bride to be cake.... For order / full pict 👉 wa 08992100111 #whippywhisper#thabkyou#birthdaycakejambi#yumyum#jambicake#fondantcakejambi#sweet#instagcake#handmade#fondant#sugarart#bridetobecake#porncakes#cencored#cupcakefondant

Lilly Rigotti I don't know what say about that... It's a dream come true... #sugar #

Lilly Rigotti

  • 15.10.2017 02:36
  • 0

I don't know what say about that... It's a dream come true... #sugar #happyness #nhamy #delicia #cake #japonesecake #strawberrycake #loveit #pornfood #porncakes #liberdade #sp #saopaulo #trip

Todos Antojos ✨Tarta de Manzana✨- Sin aditivos ni conservantes🌷Consultas po

Todos Antojos

  • 15.10.2017 01:24
  • 1

✨Tarta de Manzana✨ - Sin aditivos ni conservantes 🌷Consultas por MP #tartademanzanas #tartademanzana🍎 #tarta #pornfoods #manzanas #delicias #porncakes #applecake #pasteleria

Ashley Chocolate banana pudding pie #saywhaaaat

Ashley

  • 14.10.2017 17:11
  • 1

Chocolate banana pudding pie #saywhaaaat

Cake Decorating 1,2 or 3? Which one do you prefer?😁 DOUBLE TAP & TAG your friendF

Cake Decorating

  • 14.10.2017 16:26
  • 2

1,2 or 3? Which one do you prefer?😁 DOUBLE TAP & TAG your friend FOLLOW US @cakedecorating_org

Cake Decorating After the dinner you can eat this one as a dessert!😋😍 FOLLOW US

Cake Decorating

  • 14.10.2017 10:26
  • 1

After the dinner you can eat this one as a dessert!😋😍 FOLLOW US @cakedecorating_org

Novimckain a little treat for my self ❤ #hokkaido #chesetart #chessecake #pornf

Novimckain

  • 13.10.2017 17:57
  • 1

a little treat for my self ❤ #hokkaido #chesetart #chessecake #pornfood #porncakes #instafoods #instafoodie #yummy #deliciousfoods #deliciousfood #delicious #jakartaculinary #kulineraddict #kulinerjakarta #kulinerjkt

Cake Decorating Yes or no?😜 FOLLOW US @cakedecorating_org

Cake Decorating

  • 13.10.2017 16:33
  • 3

Yes or no?😜 FOLLOW US @cakedecorating_org

yusufalmahasnah يوسف المحاسنه Eres, sin duda, mío. Y yo, sin duda, tuya. No importa nada. No import

yusufalmahasnah يوسف المحاسنه

  • 13.10.2017 09:58
  • 12

Eres, sin duda, mío. Y yo, sin duda, tuya. No importa nada. No importa lo que hagamos, lo que deseemos, lo que esperemos. No importa otra vez la distancia, ni esa pequeña muerte de la ausencia; no importa ya ni el tiempo, ni el olvido, ni la sangre buscándote, ni el mutilado encuentro. Eres ya mío, mío, sin palabras, sin giros, sin metáforas; mío ya sin ti mismo, cómo tuya sin mi: los dos en uno, sin nosotros.

Eve's  Cakery N Oh Yes!!!! Can't Saying AnyThin' 😂😂 #onlinecakeshop #cakemakas

Eve's Cakery

  • 13.10.2017 04:45
  • 0

N Oh Yes!!!! Can't Saying AnyThin' 😂😂 #onlinecakeshop #cakemakassar #evescakery #chococupcakes #bridetobecake #porncakes #cakelyfe #cakeideas #f52grams

mamamcakeandcookies Alhamdulillah 😊Dipesan untuk suaminya yg tercinta, semoga kalian

mamamcakeandcookies

  • 13.10.2017 04:43
  • 1

Alhamdulillah 😊 Dipesan untuk suaminya yg tercinta, semoga kalian bahagia dan langgeng selalu yaaaaa 😊😊 Requestnya "decor yg simple aja taa, coklatnya serut dan pakai tulisan" Asli ini tuh tadinya tulisannya lumayan panjang. Dan hayati mana bisaa nulis diatas coklat.. akhirnya cuma sanggup nulis 1 kata aja 😅😅😅😅 . Waktu decor cake ini diiringi suara petir, suara hujan, angin kencang dan krumpyangaaann suara gelas pecah sama anak lanang ... romantis ya maak suasananya 😅😅 Motretnya pun saat mendung bergelayut, gelap bagai tak ada cahaya kehidupan.. 😁 Yang penting sempet terfoto yaa.. dan semoga di suka cakenya 😊😙 . WA : 0895 3298 07252 . #blackforestcake #simplebirthdaycake #birthdaycake #decorcake #instacake #porncakes #strawberry #chocolate #cakebirthday #kuliner

mo_artycakes ,Solihull #buttercreamicing #flowerstagram #sugardaddy #sugarflowers #sugarfacto

mo_artycakes ,Solihull

  • 12.10.2017 21:36
  • 2

#buttercreamicing #flowerstagram #sugardaddy #sugarflowers #sugarfactory #sugarart #sugarcookies #artistsoninstagram #loveflowers #cupcakedecorating #cupcakes #cakes #cakeart #cakeidea #porncakes #poshcakedesigns #beautifulcake #cakedecorating #cakedecor #icingsugar #icingflowers

Barbarella 👸🏼 Spread love like you would maple syrup on pancakes 🥞🍯🍁🍌 #t

Barbarella 👸🏼

  • 12.10.2017 14:47
  • 5

Spread love like you would maple syrup on pancakes 🥞🍯🍁🍌 #thursdayvibes #breakfastathome #spreadlove

Adultbook 😍😍 Tag friends😂😂#pornart #porncakes #pornporn #pornbike #

Adultbook

  • 12.10.2017 12:56
  • 1

😍😍 Tag friends😂😂 #pornart #porncakes #pornporn #pornbike #porncar #pornmovie #pornovideo #miakhalifa #viral #videoporn

Cake Decorating This is a little perfection😍😋 DOUBLE TAP and TAG your friend bel

Cake Decorating

  • 12.10.2017 11:58
  • 1

This is a little perfection😍😋 DOUBLE TAP and TAG your friend below👇 FOLLOW US @cakedecorating_org

LOFFINS - BAKING BLOGGER Tak prezentuje się wierzch malowanego tortu 🍰 #cakes #cake #loffin

LOFFINS - BAKING BLOGGER

  • 12.10.2017 11:30
  • 0

Tak prezentuje się wierzch malowanego tortu 🍰 #cakes #cake #loffins #cakestagram #instastory #instadiary #food #blog #pornfood #porncakes #nikon #colorful #artist #pink #beautiful #birthday

Barbarella 👸🏼 On Wednesdays we wear pink pajamas whilst eating big fat fluffy Americ

Barbarella 👸🏼

  • 11.10.2017 12:41
  • 9

On Wednesdays we wear pink pajamas whilst eating big fat fluffy American pancakes 🥞🍌🍓☕️🎀 #pancakepornisback #porncakes #ifyouthinkproteinpancakesarepancakesiwillfightyou #onwednesdayswewearpink

Sara Leitão oficialmente aberta a época das panquecas de abóbora 🎃🍂 • ci

Sara Leitão

  • 10.10.2017 11:45
  • 18

oficialmente aberta a época das panquecas de abóbora 🎃🍂 • cinnamon, coconut, peanut butter pumpkin pancakes 🙈 • bom dia! #pancakes #morning #porncakes #breakfast #healthy #healthyfood #sugarfree #pumpkin #fallfoods #sogood #peanutbutterlover #delish #instafood #foodporn #fuel #bomdia

PeanutButter_nLashes Honestly @giraffesnaps do some of the best pancakes I’ve ever had...

PeanutButter_nLashes

  • 10.10.2017 10:13
  • 1

Honestly @giraffesnaps do some of the best pancakes I’ve ever had... 🥞 and I’ve had a lot 😂😝 Take me back #MyMan #MyFish 😘 #pancakes #porncakes #giraffe #bacon #coffee #eattogrow #nutritious #treats #Training #dedication #determination #deliciousfood #food #fuel #refuel #recovery #foodies #foodporn #FoodComa #beyou #hatersgonnahate #takemeback

Cake Decorating Chocolate&Cream Cake Dessert!😋 DOUBLE TAP & TAG your friend below

Cake Decorating

  • 09.10.2017 23:52
  • 4

Chocolate&Cream Cake Dessert!😋 DOUBLE TAP & TAG your friend below👇 FOLLOW US @cakedecorating_org

Cake Decorating This is a good view!😍 DOUBLE TAP & TAG your friend below👇 FOLLO

Cake Decorating

  • 09.10.2017 21:45
  • 1

This is a good view!😍 DOUBLE TAP & TAG your friend below👇 FOLLOW US @cakedecorating_org

Aimèe Happy Thanksgiving Canada 🇨🇦🍂🐓🎃 Thankful for life, my f

Aimèe

  • 09.10.2017 20:52
  • 1

Happy Thanksgiving Canada 🇨🇦🍂🐓🎃 Thankful for life, my family & pumpkin of course 🎃 🎃🎃 📷Pumpkin pancakes with Greek yogurt pumpkin "fluff". Check a few posts back for the recipe ✌🏽

Christopher Wade Boyse, MBA It's a holiday here in Canada so I went all-in for my CHAI SPICE APPLE

Christopher Wade Boyse, MBA

  • 09.10.2017 18:49
  • 11

It's a holiday here in Canada so I went all-in for my CHAI SPICE APPLE PROTEIN PANCAKES topped with extra apples, one Oreo cookie and Gay Lea real coconut whipped cream (only 30 cals in a generous squirt). . Swipe left to see how this ended up! 😅 ⬅️⬅️⬅️ . Pancake recipe is on my blog. #Linkinbio 👆 . .

Ema Emanuela Cakes🍇#instacakes #foodie #designcakes #yummy #yumm #delish #vegan

Ema Emanuela

  • 09.10.2017 15:59
  • 1

Cakes🍇#instacakes #foodie #designcakes #yummy #yumm #delish #vegan #inspo #fashionista #fashion #fashionblogger #celebrity #magazine #luxury #luxurytravel #luxurywedding #luxuryfashion #luxurydesign #elegant #style #porncakes #fitness #motivation #beach #

Mundo Dulce #chocococo #cake #cococake #chococake #chocolatelover #chocolatelovers

Mundo Dulce

  • 09.10.2017 02:08
  • 0

#chocococo #cake #cococake #chococake #chocolatelover #chocolatelovers #chocolate #chocoadictos #chocoaddict #cakeslovers #cakestagram #cakes #cococake #merengue #porncakes #porncake #yummy #like4like #likeforlike esta nueva receta esta inspirada en la persona mas amante del coco que conozco @carlosdanielsosacampos a cada rato m recuerda las propiedades que tiene asi q debe ser una de sus favoritas ampliando nuestro menu

🍩 Kirsten RDN 🍩 Every weekend I like to go crazy in the kitchen and make something rid

🍩 Kirsten RDN 🍩

  • 09.10.2017 01:07
  • 7

Every weekend I like to go crazy in the kitchen and make something ridiculous because ya know balance ⚖ and it helps me keep my sanity. so today I made Peanut butter cup protein pancakes with a bourbon pecan pb cup core 🍽. If you look close you can see the pb cup core peeking in the back. I used @phorosnutrition protein pancake mix to make a chocolate and pb pancake for the base and for the pb cup core I made homemade pb cups made with @reghomemade bourbon pecan peanut butter. Full recipe and directions will be below! -------------- Thank you to @phorosnutrition for sending me some pancake mix to play around with!

SweetMamaMels 🥞🥞🥞3 Ingredient Gluten Free Protein Pancakes 🥞🥞🥞Can

SweetMamaMels

  • 08.10.2017 21:25
  • 3

🥞🥞🥞3 Ingredient Gluten Free Protein Pancakes 🥞🥞🥞 Can you tell I love pancakes? 😋😍 These bad boys, by yours truly 👩🏻‍🍳 are simple and so easy to make, topped with #coconutbutter and bananas. 🙌🏼 Try some #CocoNutter on your next stack! #gamechanger #coconutbutter #porncakes #pancakes #allnatural #glutenfree #proteinpancakes #easyrecipes #easymeals #mealprep #mealprepideas #healthy #healthybreakfast #food #foodporn #banana #nutbutter #fitnessmeals #quickmeals

Lauren alotta chocolate before a long day of studying 🍫📚as usual made

Lauren

  • 08.10.2017 21:20
  • 8

alotta chocolate before a long day of studying 🍫📚 as usual made with @leanfitbrand and don't forget to swipeee

Cake Decorating Don't DOUBLE TAP this if you don't  LIKE! 😍😜 👉 FOLLOW US @c

Cake Decorating

  • 08.10.2017 20:01
  • 2

Don't DOUBLE TAP this if you don't  LIKE! 😍😜 👉 FOLLOW US @cakedecorating_org

Ema Emanuela Yumm🌸 #sundaycake #vanillacake #flowers #yummy #cremecake #yumm #de

Ema Emanuela

  • 08.10.2017 15:06
  • 1

Yumm🌸 #sundaycake #vanillacake #flowers #yummy #cremecake #yumm #delish #vegan #decoration #inspo #fashionista #fashion #fashionblogger #fitness #motivation #beach #saludable #healthy #design #luxurydesign #luxury #luxurytravel #luxurywedding #luxuryfashion #photography #photographer #porncakes #foodie #foodie

KersTin

KersTin

  • 08.10.2017 12:09
  • 0

"Wenn sie gerade nichts zu tun haben, bitte tun Sie es bei uns."..... Aber Hallo, schönes Ambiente!! #torten #cakeinstyle #cake #cafe #coffee #erdbeertorte #erdbeerpuddingtorte #kaffeehausgräfe #kaffeehaus #konditor #konditormeister #backebackekuchen #visitjena #gestern #jena #thüringen #wasmussdasmuss #cakeofinstagram #loveit #travel #visit #eatme #eat #porncake #porncakes

Cake Decorating Have a nice sunday!👌😋 FOLLOW US @cakedecorating_org

Cake Decorating

  • 08.10.2017 11:35
  • 1

Have a nice sunday!👌😋 FOLLOW US @cakedecorating_org

Maria Wiszniewska Łódź Poland Pyszne ciasto drożdżowe #yummycake #pyszneciasto #wiemcojem #healthy

Maria Wiszniewska Łódź Poland

  • 07.10.2017 22:01
  • 2

Pyszne ciasto drożdżowe #yummycake #pyszneciasto #wiemcojem #healthyfood #homefood #homecake #homemade #porncakes #dessert #healthydessert #yummyfood #caketime #mniammniam #yumyum #tortwisz

Luana Katekawa Para uma tarde chuvosa:Upside down Apple Cake! 🍏 ❤️ Ingredient

Luana Katekawa

  • 07.10.2017 20:28
  • 2

Para uma tarde chuvosa: Upside down Apple Cake! 🍏 ❤️ Ingredientes: - 2 maçãs (eu usei a verde) - 2/3 xic açúcar mascavo - 2 xic farinha de trigo - 3 ovos - 1/2 colher de sopa de canela em pó - 1 colher de sopa de fermento em pó - 3/4 xic óleo No liquidificador bater os ovos, 1 maçã sem casca, óleo e o açúcar. Reservar. Em um bowl misturar a farinha e a canela. Juntar o líquido no seco. Cortar 1/2 maçã (sem casca) em cubinhos e misturar na massa. Adicionar o fermento. Cortar 1/2 maçã (sem casca) em fatias meia lua e colocar em uma forma untada e logo em seguida colocar a massa por cima! Forno pré-aquecido a 180graus. Assar por 45 minutos (ou fazer o teste do palito). Dica: servir o bolo quente pra morno com uma bola de sorvete de creme! #upsidedownapplecake #upsidedowncake #boloinvertido #greenapple #apples #maçã #bolo #cake #recipe #receita #receitafacil #sabado #receitaparaofimdesemana #confeitariaamadora #porncakes #confeitaria #bolodevo #bolofofo #applecinnamoncake #macaecanela #comerdejoelhos #saturday #recipefortheweekend #sabadochuvoso

Ashley Lenny and Larry cookie with some proyo #fillthosemacros

Ashley

  • 07.10.2017 19:07
  • 6

Lenny and Larry cookie with some proyo #fillthosemacros

mamamcakeandcookies Tau nggak.. ini Cake penuh DRAMA juga looh kemarin 😅😅Drama canc

mamamcakeandcookies

  • 07.10.2017 16:54
  • 0

Tau nggak.. ini Cake penuh DRAMA juga looh kemarin 😅😅 Drama cancel yg harus nya minggu lalu jadinya malah sekarang karna kang kuenya sakit, drama tabung gas, kompor mati, drama beli strawberry nya, decor cake sampe jam 1 malem pulaa. Alhamdulillah nya yg order tuh sabaaaarrrr banget banget.. disuka juga cake nya. Pokoknya tengkyuuu banget dan lop yu pull ya saayy 😙😘😘 . WA : 0895 3298 07252 . #blackforestcake #simplebirthdaycake #birthdaycake #decorcake #instacake #porncakes #strawberry #chocolate

Krysia Healty vegan carrot cake by jadlonomia. Thank you so much. Yours recip

Krysia

  • 07.10.2017 14:02
  • 1

Healty vegan carrot cake by jadlonomia. Thank you so much. Yours recipes are simple, fast and delicious 😋😋😋#veggan #carrotcake #recipe-jadlonomia #jadłonomia #pornfood #porncakes #dublin #henpartyideas #vincenzo #italian #workmate #sweettreat

Mehlein Yummy Yummy 😋 #törtchen #törtchenliebe #rasberry #berry #blackber

Mehlein

  • 06.10.2017 16:26
  • 0

Yummy Yummy 😋 #törtchen #törtchenliebe #rasberry #berry #blackberry #littlecakes #deliciousfood #instacake #instafood #foodporn #pornfood #cakeporn #porncakes #kleinekuchen #kaffeekuchen #kaffeezeit #kuchenzeit

Kim Janae 🍦🍩 Can’t stop won’t stop 🥞🥞. Fluffy stack of pumpkin cakes with

Kim Janae 🍦🍩

  • 06.10.2017 16:07
  • 15

Can’t stop won’t stop 🥞🥞. Fluffy stack of pumpkin cakes with cinnamon caramel apple cream cheese slathered between each layer (ok let’s be honest it was a thin smear 😜). And sugar free syrup dripping over the edges. All the carbs for all the deadlifts later 😈. #yum #stacksonstacks #eatthefoodslifttheweights #pancakeporn #pumpkinpancakes #fallasfuck #basicbitch #gwpl #fatpowerlifter #friyay #eatbigliftbig #porncakes

Cake Decorating This is good for breakfast!😍😋 DOUBLE TAP if you like it!FOLLOW

Cake Decorating

  • 06.10.2017 10:43
  • 2

This is good for breakfast!😍😋 DOUBLE TAP if you like it! FOLLOW US @cakedecorating_org

Jacob Oh hey who dis? 🤔Haven't really been motivated to bake or make any

Jacob

  • 06.10.2017 03:57
  • 29

Oh hey who dis? 🤔 Haven't really been motivated to bake or make anything lately (worth posting anyway) but I woke up today hungry for pancakes so this is what was created.. Rainbow 🌈 Salted Freakin' 🍯 Caramel Protein 💪 Pancakes 🥞😍 . Made with: #Caramel 🍯 Apple 🍏 #LiquidMuscle Salted Freakin' Caramel Quattro Iso Whey 💪 Natural #PBandMe Powdered Peanut 🥜 Butter And of course Caramel 🍯 M&M's because why not? . #LiquidMuscleRecipes #breakfastofchampions #breakfast #brunch #cleaneats #cleanfood #drizzleporn #flexibledieting #foodcoma #foodgasm #foodporn #fitfood #fitness #healthyfood #iifym #instafood #macros #musclefood #nutrition #pancakes #pancakesunday #porncakes #protein #whey

Hannah Massey Training LLC Have you ever basic white girl can't evened SO MUCH that it gives you

Hannah Massey Training LLC

  • 06.10.2017 00:57
  • 35

Have you ever basic white girl can't evened SO MUCH that it gives you a gastrointestinal discomfort??🤔....Same. That's why I'm sharing with you my go to pancake recipe (basic B pumpkin edition)that contains ONLY 4 ingredients! I've been eating pancakes every night lately, and I've noticed an 83% increase in gains directly linked from them. ➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖ 4 INGREDIENT PUMPKIN PANCAKES⬇️⬇️⬇️ 🎃 1/4c GF pancake mix or flour (I used The pumpkin @traderjoes mix) 🎃 1/2 scoop @slapnutrition WPI 🎃 1 egg 🎃 1/4 cup pumpkin 🎃 stevia & baking powder 👉🏻mix dry, add a 1/4 cup of water and the pumpkin. Mix until pudding like texture and then whisk the egg. Cook over low heat and serve with pumpkin carbs& sugar free syrup😻 - MACROS👍🏻 Approx 35c/22p/ 6f around 280 calories ➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖ 🎃NOTE: you can't make pancakes without The presence of carbs PEOPLE. DONT DISGRACE YOURSELF AND OMIT THE FLOUR. 🎃Feel free to comment below any pumpkin flavored foods you would like to see me make😊 ask @megmo7 about the High protein cannoli, I always follow through on yalls suggestions! Hoping to include this easy pancake recipe in a new macro friendly eBook released in November or early December🤗 Discount code: HEALTHBYHANNAH saves ya 💸💸 on crack tasting supps👍🏻

Ashley If you don’t have #halotop on your #proats ... then you’re wrong

Ashley

  • 05.10.2017 23:36
  • 4

If you don’t have #halotop on your #proats ... then you’re wrong

ilConsole f.lli allegra Mousse al mascarpone,tanto per dire #🍰 #ilconsoledeiflliallegra #de

ilConsole f.lli allegra

  • 05.10.2017 19:14
  • 0

Mousse al mascarpone,tanto per dire #🍰 #ilconsoledeiflliallegra #dessert #sweettime #mascarpone #food #foodporn #cake #porncakes #dday

Fra_n San_t Primizie del mattino ☀️#pasticcerialuperini  #luperini #aragostine

Fra_n San_t

  • 05.10.2017 15:23
  • 0

Primizie del mattino ☀️#pasticcerialuperini #luperini #aragostine #cremachantilly #moussepistacchio #mousselamponi #porncakes #acquolina #picoftheday

Cake Decorating What a MASTERPIECE!😱❤️ By @deesbasementFOLLOW US @cakedecorat

Cake Decorating

  • 05.10.2017 10:35
  • 6

What a MASTERPIECE!😱❤️ By @deesbasement FOLLOW US @cakedecorating_org DOUBLE TAP if you want to eat it!

Catarina Hello hello! Kicking off this Thursday with a mountain of pancakes for

Catarina

  • 05.10.2017 08:25
  • 4

Hello hello! Kicking off this Thursday with a mountain of pancakes for breakfast 🥞 @pescience Snickerdoodle #ProteinPancakes topped with @seedandbeanchocolates espresso dark chocolate, @myproteinuk butterscotch syrup and a black fig (can you tell I’m loving fig season 🙈)

حلويات ميل فاي  - الشارقة Real Madrid shirt Cake #football #footballlover #sports #team #game #b

حلويات ميل فاي - الشارقة

  • 04.10.2017 22:00
  • 2

Real Madrid shirt Cake #football #footballlover #sports #team #game #ball #uae #sharjah #dubai #mylive #millefeuillecake #sweetheart #sweets #birthday #shirtcake #realmadrid #addidas #logo #freshcream #tasty #yummy #trends #style #porncakes #thebest #instagood #instabirthday

Ricardo Ottocento My little chocolate cake. #cake #chocolatecakes #chocolatecake #chocol

Ricardo Ottocento

  • 04.10.2017 19:44
  • 3

My little chocolate cake. #cake #chocolatecakes #chocolatecake #chocolate #porncakes #pornchocolate #cocoacake

Adena Neglia MS, RDN, CDN Chocolate Protein Pancakes to start off this hump day 👉🏻Recipe:

Adena Neglia MS, RDN, CDN

  • 04.10.2017 14:59
  • 3

Chocolate Protein Pancakes to start off this hump day 👉🏻Recipe: 1/4 cup finely chopped zucchini (I use my @ninjawarrior food chopper then microwave 30 seconds) + 1/2 scoop @cellucor molten chocolate protein powder + 1 teaspoon coconut flour + 2 tablespoons oatmeal + 1 teaspoon psyllium husk + 1/4 cup plus 1 T egg whites + 1/2 teaspoon baking soda. Blend well in the food chopper. Add the batter by the spoonful to a hot pan coated with cooking spray. Flip when the edges start to set and tops begin to bubble. I layer mine with Greek yogurt and @dsnaturalproducts peanut butter ❤️

Monia * Cake by Me * #cakebyme #cake #cakedesigner #birthdaycake #cakes #instacakes #pornca

Monia * Cake by Me *

  • 04.10.2017 14:49
  • 0

#cakebyme #cake #cakedesigner #birthdaycake #cakes #instacakes #porncakes #design #torty #tortyartystyczne #tortynazamowienie #Gdańsk #gdansk #share #animalsfondant #fondant #masacukrowa #tortyangielskie #love #family #happytime #lovemyjob #girls #boys #fit #healthy

Rachel Beax Kiddo Bonjour les amis! Vous êtes combien? Je veux partage',avec vous Mon

Rachel Beax Kiddo

  • 04.10.2017 08:25
  • 7

Bonjour les amis! Vous êtes combien? Je veux partage',avec vous Mon petit dejeuner. Creo que esta es.una.manera justa para empezar el dia😋. Chocopancakes with pistachios organic cream. Enjoy. #healthylifestyle#healthy#healthymeals#healthyfood#food#instafood#foodies#eatclean#dimagriremangiando#diet#flexibledieting#macros#fitfamily#foodlover#foodbloggeritaliani#foodblogger#breakfastofchampions#breakfast#breakfastatrachels#peanutbutter#saludable#porncakes#

Mariusz Uram #geneva #oldtowngeneva #swisschocolate #swissness #churchporn #porncak

Mariusz Uram

  • 03.10.2017 12:01
  • 1

#geneva #oldtowngeneva #swisschocolate #swissness #churchporn #porncakes

Cake Decorating Ok this is too much sweet!😱😋 Via @forkin_foodDOUBLE TAP if you'

Cake Decorating

  • 02.10.2017 23:28
  • 2

Ok this is too much sweet!😱😋 Via @forkin_food DOUBLE TAP if you'd eat it Follow US  @cakedecorating_org

IIFYM, Health, Fitness Coach Throwing it back to this weekend's chocolate chip pancakes and pan-fri

IIFYM, Health, Fitness Coach

  • 02.10.2017 22:06
  • 25

Throwing it back to this weekend's chocolate chip pancakes and pan-fried tofu. Omg guys. I wish I could share this with you. 🤤 •• For the #tofu👇🏼👇🏼 •• I bought a pre-pressed, "high protein" tofu that sliced SO WONDERFULLY. I sliced it pretty thin and then marinated it in liquid smoke, (vegan) worchestire sauce, a dash of olive oil, a dash of veggie broth, salt, pepper, and onion/garlic powder. I let it marinate for about 10-15 mins, but 30-60mins would make it SO MUCH more flavorful. Then I seared it on medium high, about 5 mins each side. I kept turning until both sides were nice and crispy/browned. 👌🏼 •• (If you drain your own tofu, make sure its got as much of the liquid out as possible.) PROTOFU Tip: freeze your tofu and then thaw it before opening/using it. For some reason it changes the texture to cook and slice better if you freeze and then thaw it! 👍🏼👍🏼👍🏼

Cake Decorating A little cake with oreo,brownie and nutella!😍 Thanks to @lickyplate

Cake Decorating

  • 01.10.2017 23:14
  • 3

A little cake with oreo,brownie and nutella!😍 Thanks to @lickyplate  DOUBLE TAP if you want a bite and FOLLOW US @cakedecorating_org

🎀 Vanessa Hello octobre 🍂 aujourd'hui on est dimanche alors c'est pâtisserie

🎀 Vanessa

  • 01.10.2017 19:23
  • 0

Hello octobre 🍂 aujourd'hui on est dimanche alors c'est pâtisserie j'ai fait un gâteau cookie au cœur chocolat de la mort qui tue 😱🍪🍫 #patisserie #cookies #pastry #homemade #faitmaison #chocolat #cake #cakedesign #layercake #moelleuxchocolat #instacook #cooking #instagood #porncakes #photography #picoftheday #instapic #yummy #monsuperbon #tropbon #dessert #dessertporn #kitchen #cuisine #cuisinemaison #home

Ema Emanuela Yumm🍂 #chocolatecupcakes #yummy #yumm #delish #vegan #inspo #fashio

Ema Emanuela

  • 01.10.2017 18:30
  • 1

Yumm🍂 #chocolatecupcakes #yummy #yumm #delish #vegan #inspo #fashion #fashionista #fashionblogger #celebrity #magazine #photography #photographer #luxury #luxurytravel #luxuryfashion #luxurywedding #porncakes #fitness #motivation #beach #saludable #healthy