striveforgreatness instagram photo

#

Liverpool FC MATCHDAY⚽️Liverpool FC vs Chelsea🏆Premier League📆25/11/20

Liverpool FC

  • 25.11.2017 12:21
  • 0

MATCHDAY ⚽️Liverpool FC vs Chelsea 🏆Premier League 📆25/11/2017 ⌚️Kick-off: 18:30 CET 📍Anfield❤️ Come on Reds! #StriveForGreatness #COYR

Orli Tollman 💗 #inspiration #happysaturday #rolemodel #domoreofwhatmakesyouha

Orli Tollman

  • 25.11.2017 12:17
  • 0

💗 #inspiration #happysaturday #rolemodel #domoreofwhatmakesyouhappy #striveforgreatness #leadership #personaldevelopment

Wisdom Motif Ride your own wave.Pursue something that makes you happy. Chase your

Wisdom Motif

California

  • 25.11.2017 12:15
  • 1

Ride your own wave. Pursue something that makes you happy. Chase your dream. People will tell you it's crazy. They'll tell you it's impossible. They'll tell you you can't do it. You can either believe them or make them believe you.

CEO @patronextracts_ If you don’t follow your heart, you might spend the rest of your lif

CEO @patronextracts_

  • 25.11.2017 12:11
  • 2

If you don’t follow your heart, you might spend the rest of your life wishing you had.

Razak Pimpong This is the field I started playing football on at James Town Ghana, a

Razak Pimpong

  • 25.11.2017 12:17
  • 0

This is the field I started playing football on at James Town Ghana, and with the dream that I had, I managed to became a pro. Footballer and had big experience in my life. if someone is out there and have a dream, go for it, there’s always a had time on the way but never give up on til you reach your goal. #nopainnogain #striveforgreatness #beinspired

I love Basketball ➡ Do you love it ?👕 Grab your NOW by clicking the link in my bio

I love Basketball

  • 25.11.2017 12:05
  • 0

➡ Do you love it ? 👕 Grab your NOW by clicking the link in my bio (profile) ➡@Basketball_cpc ❤️ Hoodie,T Shirts,Mug,Leggings,Hat... 👌 Printed in the USA 👕 Worldwide shipping 📦 💯 100% Satisfaction Guaranteed! 🏃 DoubleTap & Tag a Friend below⤵ ____________________________________ #basketball #nba #ballislife #bball #sports #dunk #basketballneverstops #cavs #kobe #lebron #basket #lakers #lebronjames #kobebryant #warriors #stephcurry #ball #striveforgreatness #cleveland #baller #dubnation #nikebasketball #curry #mvp #hoops #kicks #clevelandcavaliers #theland #stephencurry #cavsnation

KeepMovingFoward 🤩🧠👑💡💎 #focused #showstopper  #feather #feather #skirt #

KeepMovingFoward

  • 25.11.2017 12:00
  • 0

🤩🧠👑💡💎 #focused #showstopper #feather #feather #skirt #dope #fashion #white #naturalhair #sittingpretty #sitting #boss #speakitintoexistence #striveforgreatness

Deron Tan Chang Kai Across the sea admiring the city skyline, clearing the mind, ready to

Deron Tan Chang Kai

Kusu

  • 25.11.2017 12:00
  • 0

Across the sea admiring the city skyline, clearing the mind, ready to face the world 🌏 #kusu #singapore #skyline #striveforgreatness #dtrips

JP ✌ Amazing chicken!!!! 😍The lads can devour a chook 🐔https://www.

JP ✌

Singleton, New South Wales

  • 25.11.2017 11:58
  • 1

Amazing chicken!!!! 😍 The lads can devour a chook 🐔 https://www.facebook.com/lyfstyln.com.au/

Mehdy Cecina Konishiwa !!!!🇯🇵🇯🇵🇫🇷🇫🇷Tomorrow is a big day !

Mehdy Cecina

Budokan Arena

  • 25.11.2017 11:58
  • 0

Konishiwa !!!!🇯🇵🇯🇵🇫🇷🇫🇷 Tomorrow is a big day !!! #wkf #karate1 #SeriesA #okinawa #karatesbirthplace #roots #spnvernon #budonordteam #karatefamily #striveforgreatness #ipromise

KiidQwest You Can't Move Forward looking back🍁 🙏#biggerpicture #purpose

KiidQwest

Los Angeles, California

  • 25.11.2017 12:04
  • 2

You Can't Move Forward looking back🍁 🙏 #biggerpicture #purpose #goals #life #dope #creative #shared #repost #instagood #commentforcomment #tagsforlikes #levelup #1up #future #love #nature #pureimagination #striveforgreatness #legacy #instago #actor #different

 Cavs continue the winning streak 😈💪 _________________________T

  • 25.11.2017 11:54
  • 0

Cavs continue the winning streak 😈💪 _________________________ TAGS: #Cavs #CavsNation #Cle #Cleveland #Cavaliers #ClevelandCavaliers #JayGainingTrain #JayFollowParty #CashGainingTrain #Sports #Nike #Duke #KyrieIrving #StriveForGreatness #Believeland #LebronJames #KingJames #TheLand #Witness #Ipromise

 Warm days call for smoothies🌞 Not really into smoothies but this on

  • 25.11.2017 11:54
  • 0

Warm days call for smoothies🌞 Not really into smoothies but this one was pretty yum. 🍓 🍓 🍓 Unsweetened coconut milk 2 eggs 1 cup strawberries Pure vanilla 🍓 🍓 🍓 #smoothies #smoothie #bbgmums #paleo #paleofood #healthy #cleaneating #cleanandlean #healthylife #nutrition #eatwelllivewell #whole 30 #yum #yummy #yummyinmytummy #yummyfood #healthylife #striveforgreatness #fitnessaddict #stongnotskinny #cleaneater #cleaneatingrecipes #cleaneatingjourney #bbg

Richard Ji Don’t work 8 hours for a company and then go home not working on you

Richard Ji

Parnell, New Zealand

  • 25.11.2017 11:51
  • 18

Don’t work 8 hours for a company and then go home not working on your own goals! You’re not tired, you’re just uninspired 👊 - Find your passion and have dreams that you want to achieve! Work your ass off to make those dreams a reality! There are so many people who give up on their dreams because they don’t want it that bad. The hunger has to be real! When the times get tough and you’re tired, you still f**king gonna work on your goals because nothing can stop you!!! - - - - - - - —————————————- #workhard #workhardpaysoff #hardworking #workinghard #onthatgrind #motivationalwords #motivational #inspiring #motivation #dreamchaser #achievegreatness #striveforgreatness #successmindset #mindset

ron b. de la cruz At least i wasn't a little pissed on my bday coz @cavs won! 😂 #stri

ron b. de la cruz

  • 25.11.2017 11:34
  • 2

At least i wasn't a little pissed on my bday coz @cavs won! 😂 #striveforgreatness #Repost @cavs ・・・ Seven straight Wine & Gold Winners 🔥 #BlackOutTheQ | #AllForOne . . . #basketball #basket #ball #baller #hoop #balling #sports #sport #court #net #rim #backboard #instagood #game #photooftheday #TFLers #active #pass #throw #shoot #instaballer #instaball #jump #nba #bball

Spencer Delva 2 months later... hard work pays off, journey not the destination🦁

Spencer Delva

  • 25.11.2017 11:33
  • 2

2 months later... hard work pays off, journey not the destination🦁 #fitness #journey #gym #nobullshitallrealshit #goals #fitnessgoals #keepclimbing #striveforgreatness #leo #lion #dontstop

InboundTalent.eu Not anymore 🚀⠀#entrepreneur #fuckaverage #striveforgreatness #no

InboundTalent.eu

  • 25.11.2017 11:29
  • 0

Not anymore 🚀⠀ #entrepreneur #fuckaverage #striveforgreatness #noexcuses #success #nodaysoff #stayhungry #motivation #hustle #dream #bitsoftruth #dreambig #truth #hustlehard #everydamnday #nike #wealth #focus #strong #nolimits #inspiration #boss #bossbabe #quotes #winnerscircle #fuckmediocrity #win #business #nevernotworking

Meka No matter how much pain you take, the Eyes can never shed blood instea

Meka

Igbo Efon Idado Lekki

  • 25.11.2017 11:21
  • 0

No matter how much pain you take, the Eyes can never shed blood instead of tears... Smooth sea has never made good sailors. #striveforgreatness #dreamchasers #vacay #videoeditor #videoediting #adobepremiere #adobeaftereffects

Jodi Purcell Lastnight in Vegas! Had to get my selfie in one of the large mirrors!

Jodi Purcell

Bally's Las Vegas

  • 25.11.2017 11:17
  • 0

Lastnight in Vegas! Had to get my selfie in one of the large mirrors! Lol Vegas mom style. Goodnight mudufuckas! #vivalasvegas #VegasBaby #vegasnightlife #vegasstrong #momlife #selfiebeforebed #because #whynot #bedtime #imsosleepy #oldass #thanksgivingweekend #fitmom #momswithtattoos #strongnotskinny #momsthatworkout #strongmom #fitandtatted #thickfit #lovethelifeyoulive #striveforgreatness #✌🏽💜

DaVeO “ you strive, then you will succeed”🏆..❌❌❌❌ #improve

DaVeO

Firestone, Colorado

  • 25.11.2017 11:16
  • 2

“ you strive, then you will succeed”🏆 . . ❌❌❌❌ #improve #forward #fight #wing #win . #arnoldschwarzenegger #clubfitness #purpose #weightlosstransformation #comitmemt #workoutmotivation #forward #bodybuildingmotivation #healthyeating #footballseason #workhardplayhafrdertravelhardest #workethic #keepgoing #protein #striveforgreatness #fitnessmotivation #fitnesslifestyle #fitnessjourney #fitness #gymmotivation #olympiclifting #hurdles #trackandfield

Razmig Babikian #goat #striveforgreatness

Razmig Babikian

  • 25.11.2017 11:11
  • 0

#goat #striveforgreatness

val jackson #kingjames👑 #youngprince👑 #Lebron #Bronny #lebronjamesjr #cleve

val jackson

  • 25.11.2017 11:21
  • 0

#kingjames👑 #youngprince👑 #Lebron #Bronny #lebronjamesjr #clevelandcavaliers #akron #7inarow #whenkingjamesisyourDad #jamesgang #striveforgreatness #bryce #zhuri #savannah #likefatherlikeson @teamjamesfamily

 It’s really not a cute obsession.In all the time I’ve spent chat

  • 25.11.2017 11:08
  • 1

It’s really not a cute obsession. In all the time I’ve spent chatting with the lovely ladies I’m privileged to call friends, I’ve learned a lot about their significant others. One theme in particular seems to stand out. Why is he so obsessed with the past? It’s true - a lot of men think about their girlfriend’s past partners and sexual experiences. Thinking about the past occasionally is human, but obsessing over it is actually quite damaging. Gentlemen - you are with your partner because you care about them. You admire them. They have qualities that make them a candidate for becoming your life-partner. And yet, you are ruining your relationship with an incredible individual because you can’t get over things that have already happened. I want to be explicitly clear here. The number of individuals a woman has slept with means nothing. It does not define her, it is not indicative of her worth, and it is never a reason to make her feel uncomfortable. If you have lowered a woman’s self-esteem over her number, you are on your way to ruining the relationship and you are no longer a worthy partner. If you feel that this number does indicate inherent flaws, it’s actually very useful to examine why this tidbit of information makes you feel the way you do.  For a lot of men, slut-shaming and hypocrisy around numbers of sexual partners and past relationships are not something we question enough. When it comes right down to it, being a woman doesn’t make her inherently ‘dirty’ if she’s had more sex than you. Similarly, being a man doesn’t mean your colourful sexual past makes you more ‘manly.’ And if you buy into either of these socially constructed biases around genders, you have no one to blame but yourself when she finally sees through your bullshit hypocrisy and double standards. Gentlemen. It’s time to think our way to being better partners. And by that I mean critically thinking feminists, not socially constructed doorknobs. Kindest regards, ⁃Symon J. #feminism #thenewblog #newgeneration #prochoice #gentleman #themoreyouknow #engaged #motivateyourself #feministacademic #writersofinstagram #therants #continue #dapper #striveforgreatness #prochoice

The Illusionist's Foundation Day 346 of 365. Every story has its beginning. If you hope to understa

The Illusionist's Foundation

  • 25.11.2017 11:07
  • 1

Day 346 of 365. Every story has its beginning. If you hope to understand who someone is, you must understand where they came from and what shaped them.

Vytas, 24 Give it time. Give it space. Watch it grow 🌿

Vytas, 24

Carlsberg Museum

  • 25.11.2017 11:05
  • 3

Give it time. Give it space. Watch it grow 🌿

val jackson #CLUTCH 👑💪👑💪#kingjames #clevelandcavaliers #lebronjames #

val jackson

  • 25.11.2017 11:09
  • 0

#CLUTCH 👑💪👑💪 #kingjames #clevelandcavaliers #lebronjames #cavs #cavsnation #lbj #charlotte #hornets #dwighthoward #winning #7inarow #akron #striveforgreatness

Aleasha Wickes When someone says,

Aleasha Wickes

  • 25.11.2017 11:02
  • 0

When someone says, "Don't do it," or "You'll never make it," or "Get a real 'job'," what they're really saying is, "I can't, so neither should you." Imagine if Warren Buffet, Steve Jobs, Tony Robbins, Darren Hardy, or any other successful entrepreneurs listened to their naysayers. No one would know what they've done. Or how they've helped millions of others follow their dreams and succeed. So when someone says anything other than, "I believe in you," thank them and keep going. They're stuck in quicksand; you've found the rope to pull yourself out. I Believe in You. Start believing in yourself. #believeinyourself #powerofpositivity #entrepreneurship #successfulwomen #successquotes #bossladies #ibelieve #ibelieveinyou #champion #champions #striveforgreatness #achieve #financialliteracy #planning #igotthis #your #either #with #me #or #watching #me #support #amazing #lifestyle #real

 Patience is key. A lovely flower such as this not only needs soil and

  • 25.11.2017 10:54
  • 0

Patience is key. A lovely flower such as this not only needs soil and sun to blossom, but time as well. 🦋 . . . . . . . . . . . #patience #flower #beautiful #truth #believe #perserverance #dontstop #keepmoving #wordsofwisdom #wisdom #worthit #quotes #motivation #positivethinking #life #livelife #striveforgreatness #journey #bepositive #mindfulness #staypositive #passion #naturephotography #nature #blossom #spiritual #spiritualjourney #inspire #growthmindset #faith

Kyrie Irving Should i keep this account?🙈😓

Kyrie Irving

  • 25.11.2017 10:54
  • 11

Should i keep this account?🙈😓

BT Some team outdoor fitness with the boys this morning @matrixfitpk ...

BT

  • 25.11.2017 10:58
  • 1

Some team outdoor fitness with the boys this morning @matrixfitpk ... and of course, we kept it constantly varied, functional and Fun! @reebok @rxmindset2.0 @crossfit_programming @mansur.s.k @hashirmajid #MatrixFit #strongertogether #functionaltraining #performancetraining #hwpo #hardworkpaysoff #karachi #gym #gymnastics #weightlifting #olympiclifting #powerlifting #sports #reebok #bemorehuman #huntgreatness #striveforgreatness #nodaysoff #fitness #fit #fitfam #fitnessmotivation #inspiration #motivation #wod

sports highlights💯 Despite all that's happened in his career, Derrick Rose was/is one hec

sports highlights💯

  • 25.11.2017 10:53
  • 0

Despite all that's happened in his career, Derrick Rose was/is one heck of a player🌷 #derrick #rose #bulls #knicks #cavs #primerose #drose #motivation #striveforgreatness

The Legit Club Saturday morning Juice for y'all!! Believe in yourself and not what ot

The Legit Club

  • 25.11.2017 10:50
  • 0

Saturday morning Juice for y'all!! Believe in yourself and not what others think of you. The moment they say "You can't", respond by saying "I can and I will" and stay away from them. Note: naysayers say "you can't" in different ways. So, watch out for the signs and step out to prove them wrong. “Winners act like winners before they become winners. That’s how they become winners.” -Bill Walsh Deep down, most people don’t think they have what it takes to be extraordinary. It’s a self-fulfilling prophecy, of course — if you don’t believe you can, you surely won’t! Anything is indeed possible!!! #positivity #powerofpositivity #lawofattraction #mindset #motivation #dreams #Success #goals #striveforgreatness #YouDeserveMore #thelegitclub I

Simeon Olsen Awesome arm day my arms are ready to explode finished then off with 21

Simeon Olsen

Anytime Fitness of Red Lion

  • 25.11.2017 10:50
  • 0

Awesome arm day my arms are ready to explode finished then off with 21 wide grip ez-bar curl #bulking #bodybuilding #abs #physique #biceps #curlforthegirls #fitfam #striveforgreatness #model #noexcuses

StandTogetherFor🇭🇹Foundation .⚜️🙏🏾.. NO CAPTION NEEDED.. . #BORNTOSUCCEED ..--------

StandTogetherFor🇭🇹Foundation

  • 25.11.2017 10:38
  • 0

.⚜️🙏🏾 . . NO CAPTION NEEDED . . . #BORNTOSUCCEED . .-------- .#fundraiser #charity #children #vision #philanthropy #worldwide #God #striveforgreatness #STFHF🇭🇹#GOD #dream #best #boca #fortlauderdale #miami #orlando #atl #dc #nyc #LA #international #canada #haiti #paris #uk #europe #blessed

Tomato Jones Up and coming model Lando Calrissian #striveforgreatness

Tomato Jones

Century RiverPark 16

  • 25.11.2017 10:36
  • 2

Up and coming model Lando Calrissian #striveforgreatness

Wisler Productions & Marketing .⚜️.🇭🇹🌎🔝.. NO CAPTION NEEDED.. @diddy #blackexcel

Wisler Productions & Marketing

  • 25.11.2017 10:35
  • 1

.⚜️ .🇭🇹🌎🔝 . . NO CAPTION NEEDED . . @diddy #blackexcellence . . . ... #Wislerproductions #WislerExcutiveServices #Event #empire #dream #entrepreneur #best #palmbeach #wellington #boca #fortlauderdale #miami #orlando #atl #dc #nyc #LA #lasvegas #international #canada #haiti #paris #uk #europe#StriveForGreatness #celebrity #lifestyle

김태원👑 📸🔥🍁Red@timberland.....#👑 #hairstyles #fashion #패

김태원👑

Pohang

  • 25.11.2017 10:34

📸🔥🍁Red@timberland . . . . . #👑 #hairstyles #fashion #패션 #shoes #포항 #외국인 #모델 #모델인줄 #모델인척 #남자모델 #model #mood #korea #대구 #경산 #친구 #일상#좋아요 #사진 #nice #241 #timberland #한국 #🔥#mindset #studentlife #creative #striveforgreatness#❤️

Horns Basketball 12U Game day highlights 11/18/17🤘🏀#game#gameday#ball#ballislife#

Horns Basketball

San Antonio, Texas

  • 25.11.2017 10:43
  • 0

12U Game day highlights 11/18/17🤘🏀#game#gameday#ball#ballislife#ballin#ballers#team #teammates#gym#gymrats#buckets#pass#assist #score#coaching#ymca#westsideymca#run #basketballplayers#basketball#horns#hornsbasketball #theweekend#saturday#letsgo#hardwork#hustle #striveforgreatness#sanantonio

Horns Basketball 12U Game Day 11/18/17#game#gameday#game#ball#ballers#ballin#ball#bas

Horns Basketball

San Antonio, Texas

  • 25.11.2017 10:32
  • 2

12U Game Day 11/18/17 #game#gameday#game#ball#ballers #ballin#ball#basketball#gym#gymrats #basketballplayers#team#teammates #ymca#westsideymca#coaching #sanantonio#hardwork#hustle #letsgo#family#striveforgreatness #theweekend#snapchat#ballislife

CLEVELAND CAVALIERS (12-7) LeBron James bullies his way to the hole on MKG! 👊

CLEVELAND CAVALIERS (12-7)

Quicken Loans Arena

  • 25.11.2017 10:33
  • 5

LeBron James bullies his way to the hole on MKG! 👊

Director/Filmmaker/LSE Prod. FREESTYLE LOOKING FOR MUSIC PRODUCTION FOR NEW ALBUM

Director/Filmmaker/LSE Prod.

  • 25.11.2017 10:37
  • 1

FREESTYLE LOOKING FOR MUSIC PRODUCTION FOR NEW ALBUM "SOULFUL LOVE" #spotify #musicexec #musically #musicproduction #musicproducer #musicproducers #beats #universalmusic #sosodef #rocknation #music #love #passion #heartbreak #singer #singersongwriter #striveforgreatness #lebronjames #rodneyjerkins #timberland #missyelliot #tank#singer🎤 #amazon #itunes #dreambig#defjam@theofficial112@therealtank@timbaland @jermainedupri@mikecity

Steph Curry Fanpage! @stephencurry30 > Russell Westbrick

Steph Curry Fanpage!

  • 25.11.2017 10:29
  • 2

@stephencurry30 > Russell Westbrick

Public/Figure/Producer Sunkist Foreign ☀️ #anythingispossible #workhardplayhard #strivefo

Public/Figure/Producer

  • 25.11.2017 10:27
  • 3

Sunkist Foreign ☀️ #anythingispossible #workhardplayhard #striveforgreatness #nodaysoff #lifeisgood #Miami #southbeach #waves #moneyonmymind #levelup #doorsup #louboutin #redbottoms #dreads #glowup #whatatimetobealive #freebandz #rapper #producer #hiphop #ceo

Kelly Reed Fitness This picture really resonated with me after  a conversation I had with

Kelly Reed Fitness

London, United Kingdom

  • 25.11.2017 10:27
  • 6

This picture really resonated with me after a conversation I had with a learner last weekend . . 1 of our learners who was studying her fitness Pilates training course last weekend asked me - ‘how do I get to do what your doing?’ Asking how could she get to tutor & deliver courses etc So I gave her the usual spiel about which qualifications she needed etc & where to study them Then she said ‘cause there’s no courses around me, I’d make a killing delivering them’ I then explained to here that I only deliver courses near me maybe once or twice a year - if you want to be a tutor then you need to sacrifice your weekends, travel all over the country working 7 days a week You miss birthdays, anniversaries, christenings, seeing your friends & family, your friends children grown up You spend hours traveling, on the road, putting 100s miles on your car etc Yes you could get a job in a college near you (which is what I use to do) but then you have to want to teach teenagers & be paid that salary. And within seconds she’d decided ‘oh no that’s not for me then!’ It just made me smile to think that people always see the glamorous side to being a presenter - desperately wanting that dream but then when they actually see the hard work you have to do in order to get there, they realise it’s not for them! I love my job & please do not think I’m complaining about it as I would have never done this for the last 10-12 years of my life if I didn’t But you’ve got to have a passion for it, a love that’s so deep it over shouts all the tired, lonely, fed up days You’ve got to sacrifice a lot & keep sacrificing until you reach the top of your goals - have compassion, empathy & patience 🙏 So the next time you go on a course or convention, or attend someone’s workshop, remember just for a second that the person up in front of you has sacrificed a lot to get where they are, it’s not just luck #weekend #progress #professional #striveforgreatness #presenter #fplove #havepassion #beprepared #instructor #instructortraining #personaltrainer #fitnesspresenter #fitness #success #workethics #attitude #alwayslearning #alwaysprogressing #bebettertoday #success

LeBron James King me. 👑-#UPDATEKING

LeBron James

  • 25.11.2017 10:26
  • 5

King me. 👑 - #UPDATEKING

AMY CHRISTENSEN Can't wait to get back to you LA 😍💭

AMY CHRISTENSEN

  • 25.11.2017 10:25
  • 4

Can't wait to get back to you LA 😍💭

CLEVELAND CAVALIERS (12-7) LeBron James no-look pass to JR Smith for the triple! 👑

CLEVELAND CAVALIERS (12-7)

Quicken Loans Arena

  • 25.11.2017 10:24
  • 3

LeBron James no-look pass to JR Smith for the triple! 👑

ZAHAIR l 🎧🎹🇧🇧 #Nocaptionneeded

ZAHAIR l 🎧🎹🇧🇧

  • 25.11.2017 10:23
  • 3

#Nocaptionneeded

 Heeeellloo everyone, So sorry we aren't posting frequently for you al

  • 25.11.2017 10:20
  • 5

Heeeellloo everyone, So sorry we aren't posting frequently for you all, but like each and everyone of youse, we also have schedules to attend to. My little sisters have already introduced themselves, with a brief introduction. I'm the the oldest of the trio, I set up this account for me and my sisters to share our journey and walk with Jesus with you all. Our Faith in God has bought us so much strength. Our plans ahead are in the hands of our good Lord! As my sisters said in their previous post, you are all welcome here, imperfect and broken, Jesus said: come as you are! He accepts ALL! Blessings to you all from Sisters With Faith! . . . . . . . . . . #purpose #prayer #snapchat #exploretocreate #motivation #dailyinspiration #quotestoliveby #prayer #pray #lovelife #believe #achieve #faith #hope #trust #wisdom #destiny #grace #knowledge #bible #scripture #verseoftheday #christians #journey #writersofinstagram #adventure #visualsoflife #striveforgreatness #forgiveness #biblejournaling

CLEVELAND CAVALIERS (12-7) LeBron James drains the deep trey from the logo! 🔥

CLEVELAND CAVALIERS (12-7)

Quicken Loans Arena

  • 25.11.2017 10:18
  • 7

LeBron James drains the deep trey from the logo! 🔥

jamesfamilyforever Bronny Sr ×  Bronny Jr handshake....#BronnyJames #PrinceBronny #Lebro

jamesfamilyforever

  • 25.11.2017 10:20
  • 1

Bronny Sr × Bronny Jr handshake....#BronnyJames #PrinceBronny #LebronJames #KingJames #JamesGang #JamesFamily #StriveForGreatness 👑👑🔥

 WHICH ALTERNATE NBA UNIFORM IS THE BEST #cavs #clevelandcavaliers #cle

  • 25.11.2017 10:16
  • 2

WHICH ALTERNATE NBA UNIFORM IS THE BEST #cavs #clevelandcavaliers #cleveland #cavaliers #indianapacers #indiana #pacers #okc #oklahomacitythunder #oklahoma #oklahomacity #boston #bostonceltics #celtics #striveforgreatness #thisiswhyweplay #nike #nikejersey #russellwestbrook #lebronjames #kyrieirving #basketball #victoroladipo

Jeni Mae See it, Believe it, It will be.  #legendarywomen #makeithappen #strive

Jeni Mae

  • 25.11.2017 10:15
  • 0

See it, Believe it, It will be. #legendarywomen #makeithappen #striveforgreatness #newmodel #blackandwhitephotography

Forex Kong Be not afraid of greatness. Some are born great, some achieve greatnes

Forex Kong

  • 25.11.2017 10:15
  • 0

Be not afraid of greatness. Some are born great, some achieve greatness, and others have greatness thrust upon them. #swingtradelife #forex #profitsoverwages #liveaccountsonly #striveforgreatness #investmentbanking #therealamericandream #theswingtradegawd #Ionlytradedailycharts #investing #workfromhome #motivation #qotd #positivity #sayings

CLEVELAND CAVALIERS (12-7) Jose Calderon gets his revenge on Dwight Howard by knocking down the c

CLEVELAND CAVALIERS (12-7)

Quicken Loans Arena

  • 25.11.2017 10:11
  • 14

Jose Calderon gets his revenge on Dwight Howard by knocking down the contested triple in his face! 😤

Jessica https://lifenow.rocks>>>>Click the bio link + Tag a friend<<<<<zhova

Jessica

  • 25.11.2017 10:11
  • 1

https://lifenow.rocks >>>>Click the bio link + Tag a friend<<<<< zhovanik.valera Attraction is a matter of details. #Ferrari #488GTB #ItalianDesign . . . . . . . . . . VIA@ferrari #london #traveler #newzealand #mercedes #nzmustdo #travelgram #photolovers #bestoftheday #warm #vacation #mytravelgram #cntraveler #beautiful #travelbug #wanderlust #striveforgreatness #travelpics #infinitypool #drones #drone

cavs23ig® Record:12-7 😂/////////////////////////////////////////////////////////////////

cavs23ig® Record:12-7

  • 25.11.2017 10:08
  • 8

😂 /////////////////////////////////////////////////////////////////////////// (Via): @cavs23ig //follow me for more cavs & lebron content//—> @cavs23ig @kingjames @isaiahthomas @kevinlove @dwyanewade @cavs #champs #goats #cavs #kingjames #it4 #warriorsblewa3to1lead #klove #allin #offseason #2016 #world #champs #striveforgreatness #justakidfromakron #alwaysbelieve #clevelandagainsttheworld #espn #nba #abc #nbatvnba

Adrian Bossley Life can be so rewarding. Hardwork & Sacrifice, just make it happen! #

Adrian Bossley

Wyndham Resort Denarau Island

  • 25.11.2017 10:07
  • 0

Life can be so rewarding. Hardwork & Sacrifice, just make it happen! #striveforgreatness #bula #islandview #fiji #rugbywknd #gratitude365 #wyndham

CLEVELAND CAVALIERS (12-7) Dwyane Wade drives and finishes through contact! ⚡️

CLEVELAND CAVALIERS (12-7)

Quicken Loans Arena

  • 25.11.2017 10:07
  • 5

Dwyane Wade drives and finishes through contact! ⚡️

Robert Tema Back to back 3s #kingjamesway #striveforgreatness @kingjames @cavs ano

Robert Tema

  • 25.11.2017 10:06
  • 0

Back to back 3s #kingjamesway #striveforgreatness @kingjames @cavs another W.

STEPHEN JAMES FAULKNER #StriveForGreatness

STEPHEN JAMES FAULKNER

  • 25.11.2017 10:05
  • 0

#StriveForGreatness

CLEVELAND CAVALIERS (12-7) LeBron and D-Wade with the PBJ connection! 😎

CLEVELAND CAVALIERS (12-7)

Quicken Loans Arena

  • 25.11.2017 10:00
  • 6

LeBron and D-Wade with the PBJ connection! 😎

LeBron Zone 7 Straight! _____________________________________________ __________F

LeBron Zone

  • 25.11.2017 09:55
  • 0

7 Straight! _____________________________________________ __________Follow (me) @lebron.zoneig for more.________________________________________ #lebronjames #king #cavs #cavaliers #lebron #kobe #nba #basketball #striveforgreatness #kobe #steph #kd #snake #tripledouble #finals #warriors #2017 #gotime #goat #striveforgreatness #rwtw #23 @kingjames

Mario Moran We coming.... ;) #theyhatingtheynotgonnalikeit #BeastUnit #motivation

Mario Moran

  • 25.11.2017 09:53
  • 0

We coming.... ;) #theyhatingtheynotgonnalikeit #BeastUnit #motivation #changethegame #beyourownhero #striveforgreatness

Faldi Harris Selamat buat teman2 yang sudah lulus.. Sukses terus kedepannya.. Aku a

Faldi Harris

Telkom University

  • 25.11.2017 09:53
  • 1

Selamat buat teman2 yang sudah lulus.. Sukses terus kedepannya.. Aku akan menyusul kalian #striveforgreatness 👊👊👊

Jack#20 Make it happen 👊 buddy💪....#getshitdone #doyourjob #neverst

Jack#20

  • 25.11.2017 09:53
  • 0

Make it happen 👊 buddy💪 . . . . #getshitdone #doyourjob #neverstop #nevergiveup #makeithappen #winorlose #iwill #trainyourmind #trainyourself #bodypositive #positivemindset #bodyandsoul #striveforgreatness #workout #workoutmotivation #inchbyinch #businesslife #lifestyle. #motivation

LeBron Zone KING of basketball! 👑_____________________________________________

LeBron Zone

  • 25.11.2017 09:48
  • 0

KING of basketball! 👑 _____________________________________________ __________Follow (me) @lebron.zoneig for more.________________________________________ #lebronjames #king #cavs #cavaliers #lebron #kobe #nba #basketball #striveforgreatness #kobe #steph #kd #snake #tripledouble #finals #warriors #2017 #gotime #goat #striveforgreatness #rwtw #23 @kingjames

CLEVELAND CAVALIERS (12-7) LeBron James finds JR Smith cutting to the hoop! 👌

CLEVELAND CAVALIERS (12-7)

Quicken Loans Arena

  • 25.11.2017 09:48
  • 4

LeBron James finds JR Smith cutting to the hoop! 👌

Jordan Leturgez May your light shine and share the great joy that is within you. Push

Jordan Leturgez

  • 25.11.2017 09:45
  • 2

May your light shine and share the great joy that is within you. Push away your concerns. #passion #trueballers #moneyteam #ballislife #handlelife #training #nevergiveup #blessed #ilovebasketball #boss #grind #money #nolimit #striveforgreatness #workfromhome #basketball #lifestyle #grind #photooftheday #basketballneverstops #mindset #entrepreneur #faith #goals #god #succeed #success

Holly Williams #life #onedayatatime #igotthis #keepgoing #striveforgreatness

Holly Williams

  • 25.11.2017 09:44
  • 0

#life #onedayatatime #igotthis #keepgoing #striveforgreatness

Astronaut Life     (THE BRAND) Astronautlife the (BRAND) making noise @bellfort3  interview, the life

Astronaut Life (THE BRAND)

  • 25.11.2017 09:44
  • 1

Astronautlife the (BRAND) making noise @bellfort3 interview, the lifestyle 👩🏼‍🚀🚀🌕🛰 #brand#clothingline#streetwear#apparel #lifestyle#culture#music#musiclife#artist#striveforgreatness#fashion#nevergiveup#stayfocused#interview

ethan Russell Wilson who? #striveforgreatness

ethan

  • 25.11.2017 09:33
  • 11

Russell Wilson who? #striveforgreatness

Cody Johnson Dark times, lead to the brightest times, so even when you think it can

Cody Johnson

  • 25.11.2017 09:29
  • 0

Dark times, lead to the brightest times, so even when you think it cant get any worse, remember that it ALWAYS can, and in those dark times, we need that tiny spark of hope thats ALWAYS deep down inside of us all! Its that spark that ignites that bright future we all dream of!!! So stay positive, keep your chin up, push through each day, and remember theres always someone to talk to, and if you dont think so, i will be that person. Ive walked the darkest of valleys these past few months, and every step seemed to get darker and darker, but now as i look up, i can see the light, and its BRIGHT AS HELL! And its all the success and dreams ive wanted my entire life, and im gonna get to that light, watch me!!! #striveforgreatness #nevergiveup #darkness #dark #light #life #livelife #everydayisagift #chinup #headheldhigh #yourneveralone

Rochelle Pastorius A difference. In four years, I’ve grown;30 pounds of muscle gained

Rochelle Pastorius

San Clemente, California

  • 25.11.2017 09:24
  • 1

A difference. In four years, I’ve grown;30 pounds of muscle gained 💪🏻 (that would have killed me back then) but better yet, a happier life & a better understanding of my goals. I have had a lot of ups and downs. Two years ago, I moved across the country from Minnesota to California & haven’t looked back. Got a lot of new tattoos. I can now say that I am finally starting to find who I want to be, yet, still striving to be that person. Color of phone case didn’t change though 🤷🏻‍♀️😂 • • • • #strength #transformation #igfitness #girlswithtattoos #feedthewolf #starvethefear #fitnessmotivation #personalgrowth #striveforgreatness #kinesiologymajor #newbeginnings #gains

Ilyach Ouattara Going in to the weekend with a Great feeling. Strength is coming back

Ilyach Ouattara

CTO eindhoven

  • 25.11.2017 09:28
  • 2

Going in to the weekend with a Great feeling. Strength is coming back amazingly fast after my little ankle injury. Did 1 set with 170 x 3 then went up to 180 x 2. Niew goal set is to reach 200 before the end of the year 💪🏾 🔸 🔸 🔸 PS: peep the Moobs dance at the end 😏🕺🏾 🔸 🔸 🔸 🔸 🔸 🔸 #deadlift #powerlifting #strength #training #workout #noweakness #injuryrehab #goalsetting #eindhoven #cto #boobiedance #moobs #bodybuilding #fitness #fitlife #lyfestyle #igfit #fitbelgium #fitfam #fitdutchies #fitfamnl #keepgoing #keepgrinding #keepgrowing #striveforgreatness 👑